PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK06396.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 73aa    MW: 8787.87 Da    PI: 9.186
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK06396.3genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.16.1e-112166146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r++WT+eEd+ l+  v++ G  +W  Ia+ + ++Rt+ qc  r+q 
        PK06396.3 21 RNPWTAEEDKYLLLFVQEKGISNWIDIAASLRTNRTPFQCLARYQR 66
                     79******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.52E-16970IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-131169IPR009057Homeodomain-like
PROSITE profilePS5129411.4531672IPR017930Myb domain
SMARTSM007172.1E-72070IPR001005SANT/Myb domain
PfamPF002491.1E-92166IPR001005SANT/Myb domain
CDDcd001672.30E-72368No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
XMLQQPRLYR WLNFEDPLIN RNPWTAEEDK YLLLFVQEKG ISNWIDIAAS LRTNRTPFQC  60
LARYQRSLNV SIL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882876.11e-31PREDICTED: uncharacterized protein LOC107418690
TrEMBLW9RFI81e-30W9RFI8_9R
STRINGPOPTR_0015s04260.16e-25(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.19e-27myb domain protein 4r1